PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G21190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 424aa    MW: 44654 Da    PI: 9.1311
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G21190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.9e-41176252177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++sg++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  OPUNC06G21190.1 176 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 252
                      6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-35169238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.16E-39175254IPR004333Transcription factor, SBP-box
PfamPF031104.2E-31177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MMSGRMNAAG DESSFPFGAM QAPGGTTYVG FDHGAAAVAA AAAAAQRAGM QQQHHHHHHH  60
MYDGLDFAAA MQFGGQEAPQ LLALPPSMAP MAAPPPMPLP LQMPVPMPGD VYPALGIVKR  120
EGGGGQDASG RIGLNLGRRT YFSPGDMLAV DRLLMRSRLG GVFGLGFGGA HHQPPRCQAE  180
GCKADLSGAK HYHRRHKVCE YHAKASVVAA SGKQQRFCQQ CSRFHVLTEF DEAKRSCRKR  240
LAEHNRRRRK PATTTTTAAA AKDAAAAVAA GKKPSGATTS YTGDSKNVVV SMSAAKSPIS  300
SNTSVISCLA EQGKQAAARP TALTLGGAPP PHESSAQLGA VLHAHHHHHH HHQQDHMQVS  360
SLVHINGGGG SNNILSCSSV CSSALPSTAT NGEVSDQNND NSHNNGSNNN NNNNNMHLFE  420
VDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-301772501184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1233250KRSCRKRLAEHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642406.11e-166PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT91e-168SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-168SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A0E0LE870.0A0A0E0LE87_ORYPU; Uncharacterized protein
STRINGORGLA06G0196600.11e-166(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-49squamosa promoter binding protein-like 8